Name:
PNGase F Protein
Synonyms:
Peptide-N(4)-(N-acetyl-beta-D-glucosaminyl) asparagine amidase F
Species Name:
Elizabethkingia miricola
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
P21163
Gene Id:
Ala41-Asn354APADNTVNIKTFDKVKNAFGDGLSQSAEGTFTFPADVTTVKTIKMFIKNECPNKTCDEWDRYANVYVKNKTTGEWYEIGRFITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKGREYSVDFDIVYGTPDYKYSAVVPVIQYNKSSIDGVPYGKAHTLGLKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQHQLGALGCSANPINNQSPGNWAPDRAGWCPGMAVPTRIDVLNNSLTGSTFSYEYKFQSWTNNGTNGDAFYAISSFVIAKSNTPISAPVVTN
Molecular Weight:
35.7kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Liquid
Endotoxin Name:
null
Reconstitution:
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
20 mM Tris-HCl, 50 mM NaCl, 5 mM EDTA, 50% Glycerol, pH7.5
Quality Statement:
Peptide: N-glycosidase F (PNGase F) is an asparagine amidase produced by Flavobacterium meningosept-icum that serves as a useful tool in the research on protein N-glycosylation. Recombinant expression in E.coli. The cleavage site of PNGase F is the amide bond between N-acetylglucosamine (GlcNAc) and aspartate residues on the medial side of the glycoprotein, and converts aspartyl to aspartic acid on the enzymolysis protein. This product is often used for complete deglycosylation of antibodies and their associated proteins.The PNGase F Glycan Cleavage Kit includes all components necessary to perform the enzymatic removal of almost all N-linked oligosaccharides from glycoproteins. The kit includes recombinant Peptide N-Glycosidase F(PNGase F) enzyme, which cleaves N-glycan chains at the innermost GlcNAc and asparagine residues of high mannose, hybrid, and complex oligosaccharides, and a 10X reaction buffer.
Reference:
1. Frank Maley and Robert B. Trimble and Anthony L. Tarentino and Thomas H. Plummer Jr. Characterization of glycoproteins and their associated oligosaccharides through the use of endoglycosidases[J]. Analytical Biochemistry, 1989.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Canf1 Protein
TL1A/TNFSF15 Protein
Popular categories:
Intercellular Adhesion Molecule 3 (ICAM-3)
Ubiquitin Conjugating Enzyme E2 L6
