IL-2R alpha/CD25 Protein | Adenosylmethionine

Name:
IL-2R alpha/CD25 Protein

Synonyms:
IL2RA, CD25, p55, IL2-RA, IL-2-RA

Species Name:
Mouse

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P01590

Gene Id:
Glu22-Lys236, with C-terminal 8*His ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYKGGGSHHHHHHHH

Molecular Weight:
43-65kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
The pleiotropic interleukin-2 (IL-2) cytokine is a central modulator of immune responses by shaping the differentiation and effector function of T cells. The IL-2 receptor α (IL-2Rα) is the unique chain of the trimeric IL-2 receptor and increases affinity and cells’ responsiveness to IL-2. IL-2Rα can be cleaved by different proteases resulting in soluble IL-2Rα (sIL-2Rα). Contrary to cell-bound IL-2Rα, several studies point to an antagonist role of sIL-2Rα on IL-2 signaling by interfering with binding of IL-2 to the cell-bound receptor and diminishing STAT5 phosphorylation, thereby inhibiting induction of the expression of cell bound IL-2Rα and increasing differentiation of the T cell response towards a T helper 17 phenotype, a T cell phenotype normally inhibited by IL-2.

Reference:
1、Driesen J. et al. (2008) CD25 as an immune regulatory molecule expressed on myeloid dendritic cells. Immunobiology. 213(9-10): 849-858.2、Bien E. et al. (2008) Serum soluble interleukin 2 receptor alpha in human cancer of adults and children: a review. Biomarkers. 13(1): 1-26.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PVR/CD155 Protein
FGFR-2 alpha IIIc Protein
Popular categories:
Activin/Inhibins
Serine/Threonine Kinase Proteins

Author: Adenosylmethionine- apoptosisinducer

Related Posts