LIF Protein | Adenosylmethionine

Name:
LIF Protein

Synonyms:
LIF, Leukemia Inhibitory Factor, HILDA, MLPLI, CDF, DIA

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P09056

Gene Id:
Ser24-Phe203 SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Molecular Weight:
20kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 200mM NaCl, pH8.0

Quality Statement:
The leukemia inhibitory factor (LIF) belongs to the interleukin-6 (IL-6) cytokine family, which is involved in various biological processes including inflammation, immune responses, and embryonic development. Leukemia inhibitory factor is a glycoprotein growth and differentiation factor with pleiotropic activity. LIF has potent effects on the hematopoietic system, including megakaryocyte progenitor cells. In addition, LIF has bone regeneration activity, induces cachexia and acute-phase response in hepatocytes, and inhibits adipogenesis, to mention the more important activities. In vivo LIF treatment in monkeys and rodents was followed by signs of general toxicity, cachexia, acute-phase reaction, and stimulation of hematopoiesis. The safety margin for possible therapeutic effects on hematopoiesis seems to be very narrow.

Reference:
1、Ryffel B. et al. (1993) Pathology induced by leukemia inhibitory factor. International Review of Experimental Pathology. 34: 69-72.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Serum Albumin/ALB Protein
SDC4 Protein
Popular categories:
CD271/NGFR
Fc gamma RIII/CD16

Author: Adenosylmethionine- apoptosisinducer

Related Posts