Share this post on:

Name:
Fc γ RIV/CD16-2 Protein

Synonyms:
Low affinity immunoglobulin gamma Fc region receptor IV;CD16-2;Fc γ RIV

Species Name:
Mouse

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
A0A0B4J1G0-1

Gene Id:
GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQGGGSGGGSHHHHHHHH

Molecular Weight:
28-35kDa(Reducing)

Purity:
>95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Fc γ RIV (Low affinity immunoglobulin gamma Fc region receptor IV), also known as CD16-2 (Fc γ RIV), belongs to the Fc γ receptor family. Fc γ receptors can be divided into three types: Fc γ RI (CD64), Fc γ RII (CD32) and Fc γ RIII (CD16). Fc γ RI (CD64) has a high affinity for IgG monomers, while Fc γ RII (CD32) and Fc γ RIII (CD16) have relatively low affinity for IgG. Human CD16 is encoded by two genes, Fc γ RIIIA and Fc γ RIIIB. The gene sequence of CD16-2 is more similar to human Fc γ RIIIA protein. Fc γ RIV binding with IgG2a can promote osteocyte differentiation, while binding with IgE can promote macrophage-mediated phagocytosis, antigen presentation and pro-inflammatory cytokines production.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
B7-H4 Protein
XG/Xg blood group Protein
Popular categories:
CD200
DSG4

Share this post on:

Author: Adenosylmethionine- apoptosisinducer