Name:
IL-22 Protein
Synonyms:
IL22, IL-D110, IL-TIF, ILTIF, TIFIL-23, TIFa, zcyto18, interleukin 22
Species Name:
Mouse
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
Q9JJY9
Gene Id:
Leu34-Val179 MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Molecular Weight:
16kDa
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris, 150mM NaCl, pH8.0, 1mM TCEP
Quality Statement:
Interleukin-22(IL-22) is a member of the IL10 family of cytokines that mediate cellular inflammatory responses and functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. IL-22 has a role in the remodeling of the uterine tissue in the inflammatory environment by regulating epithelial-mesenchymal transition markers called E- and N-cadherin. Therefore, IL-22 contributes to the proper regeneration of endometrial layers after inflammation-triggered abortion. Thus, it might have a practical significance to be utilized as a treatment option postpartum (enhanced regeneration function) and in secondary infertility caused by inflammation (enhanced barrier/protector function). IL-22 is a crucial cytokine that regulates host immunity in infectious diseases, including COVID-19 (disease caused by SARS-CoV-2).
Reference:
1、Ganieva U. et al. (2022) IL-22 regulates endometrial regeneration by enhancing tight junctions and orchestrating extracellular matrix. Front Immunol. 13:955576.2、Pavlidis P. et al. (2022) Interleukin-22 regulates neutrophil recruitment in ulcerative colitis and is associated with resistance to ustekinumab therapy. Nat Commun. 13(1): 5820.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Neurofascin Protein
VE-Cadherin Protein
Popular categories:
Progesterone Receptor
CD283/TLR3