Share this post on:

Name:
Fc γ RIIB/CD32b Protein

Synonyms:
Fc gamma RIIB , CD32b;;Fc gamma Receptor IIB/C, CD32, CD32b,CDw32

Species Name:
Mouse

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P08101-1

Gene Id:
THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRGGGGSGGGSHHHHHHHHHH

Molecular Weight:
33-43kDa(Reducing)

Purity:
>95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Fc γ RIIB, also known as CD32b, is a low affinity inhibitory receptor for the Fc part of the IgG molecule. It is a single-channel type I membrane protein with two IgG-like C2 (immunoglobulin-like) domains. Fc γ RIIB is expressed on B cells, macrophages, neutrophils, mast cells and bone marrow dendritic cells, and participates in B cell phagocytosis of immune complexes and regulation of antibody production. In some cases, it can promote cell apoptosis. CD32b may also be a target for monoclonal antibodies in the treatment of malignant tumors.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TNF-alpha/TNFSF2 Protein
ALCAM/CD166 Protein
Popular categories:
TLK1
Epiregulin

Share this post on:

Author: Adenosylmethionine- apoptosisinducer