Name:
Fc γ RIIB/CD32b Protein
Synonyms:
Fc gamma RIIB , CD32b;Fc gamma Receptor IIB/C, CD32, CD32b,CDw32
Species Name:
Cynomolgus
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
Q8SPW3-1
Gene Id:
APPKAVLKLEPPWINVLREDSVTLTCGGAHSPDSDSTQWFHNGNLIPTHTQPSYRFKANNNDSGEYRCQTGRTSLSDPVHLTVLSEWLALQTPHLEFREGETILLRCHSWKDKPLIKVTFFQNGISKKFSHMNPNFSIPQANHSHSGDYHCTGNIGYTPYSSKPVTITVQVPSMGSSSPGGGSGGGSHHHHHHHH
Molecular Weight:
30-35kDa(Reducing)
Purity:
>95%, by SDS-PAGE under reducing conditions
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.2
Quality Statement:
IgG Fc receptor (Fc γ R) is a member of the Ig superfamily, which plays a role in activating or inhibiting immune response. Human Fc γ Rs is identified as three types: RI (CD64), RII (CD32) and RIII (CD16) can produce multiple subtypes. There are three human Fc γ RII / CD32 genes (A, B and C), two crab eating monkeys (An and B), and one Fc γ RII B in mice. Fc γ RIIB is also called CD32b, FCG2, IGFR2. In the extracellular domain, the homology of cynomolgus monkey CD32b with human, mouse and rat is 90%, 64% and 61%, respectively. CD32 is a low affinity receptor of IgG. Fc γ RIIB was expressed on B cells, dendritic cells, monocytes, macrophages and mast cells, and had the highest affinity to IgG1, followed by IgG3, IgG4 and IgG2. Fc γ RII B can regulate the survival of plasma cells, maintain the stability of the internal environment, inhibit the maturation of dendritic cells and the release of type I interferon, inhibit the antigen presentation of mature dendritic cells, and inhibit cell phagocytosis, antibody-dependent cytotoxicity and the release of inflammatory mediators.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Animal-Free MIG/CXCL9 Protein
IL-10 Protein
Popular categories:
ENPP-7
Fc gamma RIV/CD16-2