Share this post on:

Name:
Fc γ RIIB/CD32b Protein

Synonyms:
Fc gamma RIIB , CD32b;Fc gamma Receptor IIB/C, CD32, CD32b,CDw32

Species Name:
Cynomolgus

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
Q8SPW3-1

Gene Id:
APPKAVLKLEPPWINVLREDSVTLTCGGAHSPDSDSTQWFHNGNLIPTHTQPSYRFKANNNDSGEYRCQTGRTSLSDPVHLTVLSEWLALQTPHLEFREGETILLRCHSWKDKPLIKVTFFQNGISKKFSHMNPNFSIPQANHSHSGDYHCTGNIGYTPYSSKPVTITVQVPSMGSSSPGGGSGGGSHHHHHHHH

Molecular Weight:
30-35kDa(Reducing)

Purity:
>95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.2

Quality Statement:
IgG Fc receptor (Fc γ R) is a member of the Ig superfamily, which plays a role in activating or inhibiting immune response. Human Fc γ Rs is identified as three types: RI (CD64), RII (CD32) and RIII (CD16) can produce multiple subtypes. There are three human Fc γ RII / CD32 genes (A, B and C), two crab eating monkeys (An and B), and one Fc γ RII B in mice. Fc γ RIIB is also called CD32b, FCG2, IGFR2. In the extracellular domain, the homology of cynomolgus monkey CD32b with human, mouse and rat is 90%, 64% and 61%, respectively. CD32 is a low affinity receptor of IgG. Fc γ RIIB was expressed on B cells, dendritic cells, monocytes, macrophages and mast cells, and had the highest affinity to IgG1, followed by IgG3, IgG4 and IgG2. Fc γ RII B can regulate the survival of plasma cells, maintain the stability of the internal environment, inhibit the maturation of dendritic cells and the release of type I interferon, inhibit the antigen presentation of mature dendritic cells, and inhibit cell phagocytosis, antibody-dependent cytotoxicity and the release of inflammatory mediators.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Animal-Free MIG/CXCL9 Protein
IL-10 Protein
Popular categories:
ENPP-7
Fc gamma RIV/CD16-2

Share this post on:

Author: Adenosylmethionine- apoptosisinducer