Fc γ RIIA/CD32a Protein | Adenosylmethionine

Name:
Fc γ RIIA/CD32a Protein

Synonyms:
Low affinity immunoglobulin gamma Fc region receptor II-a, IgG Fc receptor II-a, CDw32, Fc-gamma RII-a, Fc-gamma-RIIa, FcRII-a, CD32, FCGR2A, FCG2, FCGR2A1, IGFR2

Species Name:
Cynomolgus

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
Q8SPW4-1

Gene Id:
QTAPPKAVLKLEPPWINVLREDSVTLTCGGAHSPDSDSTQWFHNGNRIPTHTQPSYRFKANNNDSGEYRCQTGRTSLSDPVHLTVLSEWLALQTPHLEFREGETIMLRCHSWKDKPLIKVTFFQNGIAKKFSHMDPNFSIPQANHSHSGDYHCTGNIGYTPYSSKPVTITVQVPSVGSSSPGGGSGGGSHHHHHHHH

Molecular Weight:
30-35kDa(Reducing)

Purity:
＞95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
IgG Fc receptor (Fc γ R) is a member of the Ig superfamily, which plays a role in activating or inhibiting immune response. Human Fc γ Rs is identified as three subtypes: RI (CD64), RII (CD32) and RIII (CD16). There are three human Fc γ RII / CD32 genes (A, B and C), two crab eating monkeys (An and B), and one Fc γ RII B in mice. Fc γ RIIA of cynomolgus monkey consists of extracellular domain, transmembrane domain and cytoplasmic domain. The extracellular domain includes two IgG domains. The Fc γ RIIA protein of crab-eating monkey has 89% homology with human Fc γ RIIA. CD32a is expressed in a variety of immune cells such as macrophages, neutrophils and platelets. When it binds to ligands, it initiates inflammatory responses, including cytolysis, phagocytosis, degranulation and production of cytokines. This response can be regulated by co-expression of inhibitory receptors such as CD32B.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Kallikrein-2 Protein
Prolactin Protein
Popular categories:
MIP-1 gamma/CCL9/CCL10
B7-DC/CD273

Author: Adenosylmethionine- apoptosisinducer

Related Posts