Share this post on:

Name:
TMEM219 Protein

Synonyms:
IGFBP-3R, Transmembrane protein 219, TMEM219

Species Name:
Human

Label Name:
Human Fc

Marker Name:
Unconjugated

Accession:
Q86XT9-1

Gene Id:
SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSRIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Weight:
60-65kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
TMEM219 is a recently discovered death receptor, which induces cell apoptosis by a Caspase-8-dependent mechanism, through the binding with its ligand, the Insulin-like growth factors binding protein 3 (IGFBP3). TMEM219 consists of four exons comprising the 915-base pair cDNA sequence on chromosome 16q13 and represents a 240-amino acid polypeptide. TMEM219 is expressed on pancreatic beta cells and that signaling through its ligand insulin-like growth factor binding protein 3 (IGFBP3) leads to beta cell loss and dysfunction. TMEM219 is an IL-13Rα2 binding partner that plays a critical role in many Chi3l1-induced, IL-13Rα2-mediated cellular and organ responses.

Reference:
1.\tChang-Min Lee , Chuan Hua He.IL-13Rα2 uses TMEM219 in chitinase 3-like-1- induced signalling and effector responses.Nat Commun. 2016 Sep 15;7:12752. doi: 10.1038/ncomms12752.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SHP-1 Protein
B7-H2/ICOSLG Protein
Popular categories:
CD163
VISTA

Share this post on:

Author: Adenosylmethionine- apoptosisinducer