Name:
TROP1/EpCAM Protein
Synonyms:
TROP1, EpCAM, TACSTD1, CD326, DIAR5, EGP2, EGP314, EGP40, ESA, HNPCC8, HNPCC-8, KSA, M4S1, MIC18, MK1, GA733-2
Species Name:
Mouse
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
Q99JW5
Gene Id:
QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLTGGGSHHHHHHHH
Molecular Weight:
33-38kDa
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4
Quality Statement:
Epithelial Cellular Adhesion Molecule (EpCAM), also known as KS1/4, gp40, GA733-2, 17-1A, and TROP‑1, is a 40 kDa transmembrane glycoprotein that consists of a 242 amino acid (aa) extracellular domain with two EGF‑like repeats, a 23 aa transmembrane segment, and a 26 aa cytoplasmic domain. It modulates cell adhesion and proliferation. Its overexpression has been detected in many epithelial tumours and has been associated with high stage, high grade and a worse survival in some tumour types. EpCAM has been shown to function as a calcium-independent homophilic cell adhesion molecule that does not exhibit any obvious relationship to the four known cell adhesion molecule superfamilies. However, recent insights have revealed that EpCAM participates in not only cell adhesion, but also in proliferation, migration and differentiation of cells. In addition, recent study revealed that EpCAM is the Wnt-beta-catenin signaling target gene and may be used to facilitate prognosis. It has oncogenic potential and is activated by release of its intracellular domain, which can signal into the cell nucleus by engagement of elements of the wnt pathway.
Reference:
1、Brunner A. et al. (2008) EpCAM is predominantly expressed in high grade and advanced stage urothelial carcinoma of the bladder. J Clin Pathol. 61(3):307-310.2、Trzpis M. et al. (2008) EpCAM in morphogenesis. Front Biosci. 13: 5050-5055.3、Munz M. et al. (2009) The emerging role of EpCAM in cancer and stem cell signaling. Cancer Res. 69(14): 5627-5629.4、Carpenter G. et al. (2009) EpCAM: another surface-to-nucleus missile. Cancer Cell. 15(3): 165-166.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
DBI Protein
PDIA5 Protein
Popular categories:
TGF-β2
LT beta R
