Name:
Tissue Factor Protein
Synonyms:
Coagulation Factor III, Tissue Factor, TF, F3, CD142
Species Name:
Human
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
P13726
Gene Id:
SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREGGGSHHHHHHHH
Molecular Weight:
34-41kDa
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4
Quality Statement:
Tissue factor (TF) is an integral membrane protein that is essential to life. It is the high-affinity receptor and cofactor for factor (F)VII/VIIa and plays a primary role in both normal hemostasis and thrombosis. TF is a transmembrane glycoprotein with a 219-amino acid extracellular domain, a 23-residue transmembrane region, and a 21-residue intracellular domain. With a vascular injury, TF becomes exposed to blood and binds plasma factor VIIa, and the resulting complex initiates a series of enzymatic reactions leading to clot formation and vascular sealing. In cancer patients, tumors release TF-positive microvesicles into the circulation that may contribute to venous thrombosis. TF also has nonhemostatic roles. For instance, TF-dependent activation of the coagulation cascade generates coagulation proteases, such as FVIIa, FXa, and thrombin, which induce signaling in a variety of cells by cleavage of protease-activated receptors.
Reference:
1、Morrissey J H. (2004) Tissue factor: a key molecule in hemostatic and nonhemostatic systems. Int J Hematol. 79(2): 103-108.2、Milsom C. et al. (2008) Tissue factor and cancer. Pathophysiol Haemost Thromb. 36(3-4): 160-176.3、Kasthuri R S. et al. (2009) Role of tissue factor in cancer. J Clin Oncol. 27(29): 4834-4838.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
NTNG1 Protein
RIZ1 Protein
Popular categories:
IL-2
DDR2
