Share this post on:

Name:
Galectin-4 Protein

Synonyms:
Galectin-4, LGALS4, L36LBP, Antigen NY-CO-27, Lactose-binding lectin 4

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P56470-1

Gene Id:
HHHHHHHHMAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI

Molecular Weight:
38-42kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4, 2mM DTT

Quality Statement:
Galectins are a family of carbohydrate-binding proteins with specificity for N-acetyl-lactosamine-containing glycoproteins.Galectin-4, a tandem-repeat-type lectin with affinity to sulfatide and nonsialylated termini of N-glycans, has the ability to regulate adhesion of cells to ECM components and is also involved in polarized membrane trafficking.Galectin-4 expression is concentrated within microvilli in the gastrointestinal epithelium, where it can interact with CD3 and bind activated T cells in the lamina propria during intestinal inflammation. Galectin-4 can also bind lung, spleen and kidney macrophages, although its expression is normally low in these tissues. Neurons and OLGs were identified as a possible source of galectin-4, both in vitro and in vivo. In culture, neurons but not OLGs released galectin-4. In co-cultures, a reduced release of endogenous galectin-4 correlated with the onset of myelination. Galectin-4-reactive sites are transiently expressed on processes of premyelinating primary OLGs, but not on neurons. Neuronal galactin-4 is a candidate for a soluble regulator of OLG differentiation and myelination.

Reference:
1、Yang R Y. et al. 2008 Galectins: structure, function and therapeutic potential. Expert Rev Mol Med. 10: e17.2、Ideo H. et al. 2007 Recognition mechanism of galectin-4 for cholesterol 3-sulfate. J Biol Chem. 282(29): 21081-21089.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD276/B7-H3 Protein
Draxin Protein
Popular categories:
IL-18
Farnesoid X Receptor

Share this post on:

Author: Adenosylmethionine- apoptosisinducer