Name:
Galectin-4 Protein
Synonyms:
Galectin-4, LGALS4, L36LBP, Antigen NY-CO-27, Lactose-binding lectin 4
Species Name:
Human
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
P56470-1
Gene Id:
HHHHHHHHMAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Molecular Weight:
38-42kDa
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4, 2mM DTT
Quality Statement:
Galectins are a family of carbohydrate-binding proteins with specificity for N-acetyl-lactosamine-containing glycoproteins.Galectin-4, a tandem-repeat-type lectin with affinity to sulfatide and nonsialylated termini of N-glycans, has the ability to regulate adhesion of cells to ECM components and is also involved in polarized membrane trafficking.Galectin-4 expression is concentrated within microvilli in the gastrointestinal epithelium, where it can interact with CD3 and bind activated T cells in the lamina propria during intestinal inflammation. Galectin-4 can also bind lung, spleen and kidney macrophages, although its expression is normally low in these tissues. Neurons and OLGs were identified as a possible source of galectin-4, both in vitro and in vivo. In culture, neurons but not OLGs released galectin-4. In co-cultures, a reduced release of endogenous galectin-4 correlated with the onset of myelination. Galectin-4-reactive sites are transiently expressed on processes of premyelinating primary OLGs, but not on neurons. Neuronal galactin-4 is a candidate for a soluble regulator of OLG differentiation and myelination.
Reference:
1、Yang R Y. et al. 2008 Galectins: structure, function and therapeutic potential. Expert Rev Mol Med. 10: e17.2、Ideo H. et al. 2007 Recognition mechanism of galectin-4 for cholesterol 3-sulfate. J Biol Chem. 282(29): 21081-21089.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD276/B7-H3 Protein
Draxin Protein
Popular categories:
IL-18
Farnesoid X Receptor