Share this post on:

Name:
FOLR2 Protein

Synonyms:
FOLR2, BETA-HFR, FBP/PL-1, FR-BETA, FR-P3

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P14207

Gene Id:
TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHGGGSHHHHHHHH

Molecular Weight:
28-35kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Folate Receptor 2 (FOLR2), also known as Folate Receptor beta, is a 38 kDa protein that mediates the cellular uptake of folic acid and reduced folates. Dietary folates are required for many key metabolic processes including nucleotide and methionine synthesis, the interconversion of glycine and serine, and histidine breakdown. Mature FOLR2 is an N-glycosylated protein that is anchored to the cell surface by a GPI linkage. Mouse FOLR2 shares 82% and 91% amino acid sequence identity with human and rat FOLR2, respectively. FOLR2 is predominantly expressed in placenta, cells of the neutrophilic lineage, and some CD34+ hematopoietic progenitor cells. It is up regulated on myeloid leukemias, head and neck squamous cell carcinomas, and several nonepithelial cancers. It is also up regulated on immunosuppressive tumor-associated macrophages as well as on macrophages and monocytes at chronic inflammatory sites including rheumatoid arthritis synovium and glioblastoma. FOLR2 knockout mice do not show gross morphological defects, but they exhibit increased sensitivity to arsenate-induced teratogenicity.

Reference:
1、Puig-Kröger A. et al. 2009 Folate Receptor β Is Expressed by Tumor-Associated Macrophages and Constitutes a Marker for M2 Anti-inflammatory/Regulatory Macrophages. Cancer Res. 69(24): 9395-9403.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CRISP-3 Protein
FCRL2 Protein
Popular categories:
NTB-A/CD352
FGFR-3

Share this post on:

Author: Adenosylmethionine- apoptosisinducer