Name:
GM-CSF Protein
Synonyms:
GM-CSF, Granulocyte Macrophage Colony Stimulating Factor, CSF-2, MGI-1GM, Pluripoietin-alpha, Molgramostin, Sargramostim
Species Name:
Mouse
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P01587
Gene Id:
MYSLSAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
Molecular Weight:
15kDa
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris, 150mM NaCl, pH8.0
Quality Statement:
Granulocyte-macrophage colony-stimulating factor (GM-CSF), also known as colony-stimulating factor 2 (CSF2), is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, natural killer cells, endothelial cells and fibroblasts that functions as a cytokine. GM-CSF was first described as a growth factor that induces the differentiation and proliferation of myeloid progenitors in the bone marrow, which also has an important cytokine effect in chronic inflammatory diseases by stimulating the activation and migration of myeloid cells to inflammation sites, promoting survival of target cells and stimulating the renewal of effector granulocytes and macrophages. GM-CSF receptor is composed of one α chain and one β chain with low and high-affinity binding to GM-CSF, respectively, and the β chain is shared with IL-3 and IL-5 receptor. GM-CSF signals via signal transducer and activator of transcription, STAT5. In macrophages, it has also been shown to signal via STAT3. The cytokine activates macrophages to inhibit fungal survival.
Reference:
1、Robertson S A. (2007) GM-CSF regulation of embryo development and pregnancy. Cytokine Growth Factor Rev. 18(3-4): 287-298.2、Waller E K. (2007) The role of sargramostim (rhGM-CSF) as immunotherapy. Oncologist. 12: 22-26.3、Clive K S. et al. (2010) Use of GM-CSF as an adjuvant with cancer vaccines: beneficial or detrimental? Expert Rev Vaccines. 9(5): 519-525.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD44 Protein
EGF Protein
Popular categories:
Frizzled-1
Cadherins