Share this post on:

Name:
GM-CSF Protein

Synonyms:
GM-CSF, Granulocyte Macrophage Colony Stimulating Factor, CSF-2, MGI-1GM, Pluripoietin-alpha, Molgramostin, Sargramostim

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P01587

Gene Id:
MYSLSAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Molecular Weight:
15kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 150mM NaCl, pH8.0

Quality Statement:
Granulocyte-macrophage colony-stimulating factor (GM-CSF), also known as colony-stimulating factor 2 (CSF2), is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, natural killer cells, endothelial cells and fibroblasts that functions as a cytokine. GM-CSF was first described as a growth factor that induces the differentiation and proliferation of myeloid progenitors in the bone marrow, which also has an important cytokine effect in chronic inflammatory diseases by stimulating the activation and migration of myeloid cells to inflammation sites, promoting survival of target cells and stimulating the renewal of effector granulocytes and macrophages. GM-CSF receptor is composed of one α chain and one β chain with low and high-affinity binding to GM-CSF, respectively, and the β chain is shared with IL-3 and IL-5 receptor. GM-CSF signals via signal transducer and activator of transcription, STAT5. In macrophages, it has also been shown to signal via STAT3. The cytokine activates macrophages to inhibit fungal survival.

Reference:
1、Robertson S A. (2007) GM-CSF regulation of embryo development and pregnancy. Cytokine Growth Factor Rev. 18(3-4): 287-298.2、Waller E K. (2007) The role of sargramostim (rhGM-CSF) as immunotherapy. Oncologist. 12: 22-26.3、Clive K S. et al. (2010) Use of GM-CSF as an adjuvant with cancer vaccines: beneficial or detrimental? Expert Rev Vaccines. 9(5): 519-525.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD44 Protein
EGF Protein
Popular categories:
Frizzled-1
Cadherins

Share this post on:

Author: Adenosylmethionine- apoptosisinducer