Name:
Fc epsilon RII/CD23 Protein
Synonyms:
Low affinity immunoglobulin epsilon Fc receptor; BLAST-2; C-type lectin domain family 4 member J; Fc-epsilon-RII; Immunoglobulin E-binding factor; Lymphocyte IgE receptor; CD23; FCER2; CD23A; CLEC4J; FCE2; IGEBF
Species Name:
Human
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
P06734-1
Gene Id:
HHHHHHHHHHGGGSGGGSDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Molecular Weight:
40-43 kDa(Reducing)
Purity:
＞95%, by SDS-PAGE under reducing conditions
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.2
Quality Statement:
Low affinity immunoglobulin epsilon Fc receptor (CD23) is a type II membrane protein secreted by single channel. CD23 is a B cell specific antigen and a low affinity receptor of IgE, which plays an important role in regulating the production of IgE and the differentiation of B cells. CD23 exists as a soluble secretory form and then acts as an effective mitotic growth factor. The increase of soluble CD23 level will lead to the recruitment of unsensitized B cells when antigen peptides are presented to sensitized B cells, thus increasing the production of allergen-specific IgE. IgE in turn upregulates the expression of CD23 and Fc epsilon RI (high affinity IgE receptor). Unlike many antibody receptors, CD23 is a C-type lectin expressed on mature B cells, activated macrophages, eosinophils, follicular dendritic cells and platelets. The IgE immune complex binds to CD23 molecules on B cells and transports them to the B cell follicles of the spleen, then the antigen is transferred from CD23+B cells to CD11c+ antigen presenting cells, and CD11c+ cells in turn present the antigen to CD4+T cells, which can lead to enhanced antibody response.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Placental Lactogen/CSH1 Protein
SCGB1A1 Protein
Popular categories:
Carbonic Anhydrase 12 (CA-XII)
CCL17
