Name:
PD-1 Protein
Synonyms:
Programmed cell death-1, CD279, Programmed death receptor 1
Species Name:
Human
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
Q15116-1
Gene Id:
LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH
Molecular Weight:
28-36 kDa (Reducing)
Purity:
＞95%, by SDS-PAGE under reducing conditions.
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4, 5% trehalose
Quality Statement:
PD-1 (programmed cell death-1) is a transmembrane protein important for regulating immune responses. It is a member of the CD28/CTLA-4 family of immunoreceptors and is expressed on T cells and pro-B cells suggesting it has a broad spectrum of immune regulation. PD-1 along with its two ligands, PD-L1 and PD-L2, prevent the activation of T cells and protect tissues from autoimmune attack. PD-1 and its ligands are also involved in reduction of infectious immunity, as well as tumor immunity. PD-1 has been shown to facilitate chronic infection and tumor progression. Drugs targeting PD-1 have shown promise in treating cancer and HIV and may be important in a variety of immune related disorders.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PPIC Protein
CLIC1 Protein
Popular categories:
TROY Protein
HABP1/C1QBP
