Share this post on:

Name:
PD-1 Protein

Synonyms:
Programmed cell death-1, CD279, Programmed death receptor 1

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
Q15116-1

Gene Id:
LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Weight:
28-36 kDa (Reducing)

Purity:
>95%, by SDS-PAGE under reducing conditions.

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4, 5% trehalose

Quality Statement:
PD-1 (programmed cell death-1) is a transmembrane protein important for regulating immune responses. It is a member of the CD28/CTLA-4 family of immunoreceptors and is expressed on T cells and pro-B cells suggesting it has a broad spectrum of immune regulation. PD-1 along with its two ligands, PD-L1 and PD-L2, prevent the activation of T cells and protect tissues from autoimmune attack. PD-1 and its ligands are also involved in reduction of infectious immunity, as well as tumor immunity. PD-1 has been shown to facilitate chronic infection and tumor progression. Drugs targeting PD-1 have shown promise in treating cancer and HIV and may be important in a variety of immune related disorders.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PPIC Protein
CLIC1 Protein
Popular categories:
TROY Protein
HABP1/C1QBP

Share this post on:

Author: Adenosylmethionine- apoptosisinducer