Name:
IL-6 Protein
Synonyms:
IL-6, BSF2, HSF, IFNB2, IL-6, Interleukin-6
Species Name:
Human
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P05231
Gene Id:
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular Weight:
21kDa
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris, 100mM NaCl, pH8.0
Quality Statement:
Interleukin-6 (IL-6) is a member of the pro-inflammatory cytokine family, induces the expression of a variety of proteins responsible for acute inflammation, and plays an important role in the proliferation and differentiation of cells in humans. Interleukin 6 was originally identified as a T cell-derived lymphokine that induces final maturation of B cells into antibody-producing cells. Recombinant human IL-6 acts on B cells activated with Staphylococcus aureus Cowan I or pokeweed mitogen (PWM) to induce immunoglobulin M (IgM), IgG and IgA production, but not on resting B cells. Anti-IL-6 antibody was found to inhibit PWM-induced Ig production, indicating that IL-6 is one of the essential factors in PWM-induced Ig production. Furthermore, IL-6 was shown to augment the primary and secondary anti-SRBC (sheep red blood cell) antibody production in mice in vivo.
Reference:
1、Heinrich P C. et al. (2003). Principles of interleukin-6-type cytokine signalling and its regulation. Biochem J. 374: 1-20.2、Rose-John S. et al. (2007) The IL-6/sIL-6R complex as a novel target for therapeutic approaches. Expert Opin Ther Targets. 11(5): 613-624.3、Dinh W. et al. (2009) Elevated plasma levels of TNF-alpha and interleukin-6 in patients with diastolic dysfunction and glucose metabolism disorders. Cardiovasc Diabetol. 8:58.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
ICAM-1/CD54 Protein
Kras4B Protein
Popular categories:
MDL-1/CLEC5A
ADAMTS18
