Share this post on:

Name:
Fc epsilon RI α Protein

Synonyms:
FCE1A;FcERI

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P12319-1

Gene Id:
VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQGGGSGGGSHHHHHHHHHH

Molecular Weight:
43-55 kDa(Reducing)

Purity:
>95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.2

Quality Statement:
Fc epsilon RI α, also known as FCER1A, is the α subunit of immunoglobulin receptor (IgE receptor). IgE receptor consists of one α subunit, one β subunit and two γ subunits. The α subunit includes extracellular domain and transmembrane domain, and the extracellular region contains two immunoglobulin-like domains, in which the proximal membrane end is the binding region to IgE Fc, and the other end is related to high affinity. The α subunit contains seven N-chain glycosylation sites, which can guide the correct folding of the α-chain. β subunit is divided into transmembrane region and intracellular region, which is a four-time transmembrane molecule with immune receptor tyrosine activation motif (ITAM). The γ subunits are connected by disulfide bonds and each has a transmembrane region. Fc epsilon RI α first initiates anaphylaxis. Allergens act on mast cells through IgE and Fc epsilon RI α, activate chemical mast cells through signal transduction, release vasoactive mediators such as histamine and bradykinin to cause hypersensitivity, or pre-release Leucotrienes, leukotrienes and platelet activating factors to cause inflammation.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CLEC10A/CD301 Protein
TPO/Thrombopoietin Protein
Popular categories:
SARS-CoV-2 E Proteins
MMP-12

Share this post on:

Author: Adenosylmethionine- apoptosisinducer