Share this post on:

Name:
G-CSF Protein

Synonyms:
G-CSF, CSF3, C17orf33, CSF3OS, GCSF, colony stimulating factor 3, CSF-3, Granulocyte Colony-Stimulating Factor

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P09919-2

Gene Id:
Thr31-Pro204MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Weight:
19kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-0.4 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 150mM NaCl, pH8.0

Quality Statement:
Granulocyte-colony stimulating factor (G-CSF) is a hematopoietic growth factor that stimulates the proliferation and differentiation of neutrophil precursor cells and enhances the functional properties of mature neutrophils. The mature human G-CSF (hG-CSF) is a glycoprotein with a molecular weight of approximately 19 kDa (174 amino acids) produced mainly by activated monocytes and macrophages. In the present scenario, hG-CSF has become one of the most widely used hematopoietic growth factor because of its proven efficacy against different forms of neutropenia caused mainly due to chemotherapy, radiotherapy and organ transplants. Mostly, it is recommended for the recovery from neutropenia after chemotherapy. The ability of G-CSF to mobilize stem cells from the bone marrow has found clinical applications in allogeneic and autologous transplantations. Also, the discovery of G-CSF as a neuroprotectant in neurological diseases like Alzheimer’s and Parkinson disease has garnered greater interests of researchers in the recent years.

Reference:
1、Takano H. et al. (2007) G-CSF therapy for acute myocardial infarction. Trends Pharmacol Sci. 28(10): 512-517.2、Klocke R. et al. (2008) Granulocyte colony-stimulating factor (G-CSF) for cardio- and cerebrovascular regenerative applications. Curr Med Chem. 15(10): 968-977.3、Kang H J. et al. (2008) G-CSF– and erythropoietin-based cell therapy: a promising strategy for angiomyogenesis in myocardial infarction. Expert Rev Cardiovasc Ther. 6(5): 703-713.4、Beekman R. et al. (2010) G-CSF and its receptor in myeloid malignancy. Blood. 115(25): 5131-6.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Animal-Free IL-37 Protein
AMIGO2 Protein
Popular categories:
CPA4
TrkA

Share this post on:

Author: Adenosylmethionine- apoptosisinducer