Name:
Galectin-4 Protein
Synonyms:
Antigen NY-CO-27, GAL4, gal-4, galectin 4, Galectin4, L-36 lactose-binding protein, L36LBP, Lactose-binding lectin 4, lectin galactoside-binding soluble 4, LGALS4
Species Name:
Human
Label Name:
null
Marker Name:
Unconjugated
Accession:
P56470
Gene Id:
AYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Molecular Weight:
36kDa
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
250mM Tris, 150mM NaCl, 3mM DTT, pH8.0
Quality Statement:
Galectins are best known for their ability to bind glycoconjugates containing β-galactose, but classification of these small proteins within the galectin family is also defined by amino acid homology within structural domains and exon/intron junctions within genes. Galectin-4 (Gal4), a tandem-repeat type galectin, is expressed in healthy epithelium of the gastrointestinal tract. Altered levels of Gal4 expression are associated with different types of cancer, suggesting its usage as a diagnostic marker as well as target for drug development. The functional data available for this class of proteins suggest that the wide spectrum of cellular activities reported for Gal4 relies on distinct glycan specificity and structural characteristics of its two carbohydrate recognition domains. Gal4, a tandem-repeat-type lectin with affinity to sulfatide and non-sialylated termini of N-glycans, has the ability to regulate adhesion of cells to ECM components and is also involved in polarized membrane trafficking.
Reference:
1、Poland P A. et al. (2022) Cloning, Expression, and Purification of Galectins for In Vitro Studies. Methods in Molecular Biology. 2442: 41-54.2、Rustiguel J K. et al. (2016) Recombinant expression, purification and preliminary biophysical and structural studies of C-terminal carbohydrate recognition domain from human galectin-4. 118: 39-48.3、Stancic M. et al. (2012) Galectin-4, a Novel Neuronal Regulator of Myelination. GLIA. 60(6): 919-935.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PCSK9 Protein
KGF/FGF-7 Protein
Popular categories:
CD217
FGFR-2
