FGF-4 Protein | Adenosylmethionine

Name:
FGF-4 Protein

Synonyms:
HBGF-4; HST Protein; HST-1; HSTF1; K-FGF; KFGF

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P08620

Gene Id:
MAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Weight:
17kDa (Reducing)

Purity:
＞95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied.6 months, -20 to -70 °C under sterile conditions after reconstitution.1 week, 2 to 8 °C under sterile conditions after reconstitution.Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 150mM NaCl, pH8.0

Quality Statement:
Fibroblast Growth Factor 4, a secreted heparin-binding protein, is a member of the fibroblast growth factor (FGF) family. FGF4 plays an essential role in the midgut patterning as it inhibits the foregut development and promotes the midgut and hindgut identity. Thus FGF4 induces the intestinal fate, repressing anterior markers such as hematopoietically expressed homeobox 1 (HEX1) and enhancing midgut markers such as PDX1 and CDX2. Also, Wnt signaling is essential to the midgut and hindgut development; high Wnt activity is required to repress foregut development and push towards an intestinal fate. As an example, the a fore mentioned transcription factor BARX1, which is expressed during foregut embryogenesis, induces SFRP1 and SFRP2 which in turn inhibit Wnt signaling, thus repressing midgut fate and favoring the foregut fate. Another crucial transcription factor of intestinal specification is CDX2. CDX2 is expressed early during the anterior-posterior formation of the gut tube and is essential for specifying the intestinal endoderm. Wnt induces the expression of CDX2, thus reinforcing its predominant role in intestinal specification.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Osteopontin/OPN Protein
IGFBP-2 Protein
Popular categories:
CD217
HGF & Receptors

Author: Adenosylmethionine- apoptosisinducer

Related Posts