Share this post on:

Name:
Angiopoietin-1 Protein

Synonyms:
AGP1; AGPT; Ang1; ANG-1; angiopoietin 1; ANGPT1; KIAA0003

Species Name:
Cynomolgus

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
XP_005563980.1

Gene Id:
REEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDFGGGSHHHHHHHH

Molecular Weight:
28-33kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied.6 months, -20 to -70 °C under sterile conditions after reconstitution.1 week, 2 to 8 °C under sterile conditions after reconstitution.Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Angiopoietin-1 (ANG-1) is a secreted glycoprotein that plays a critical role in the development and maintenance of the vascular system. It contains a N-terminal coiled-coil region and a C-terminal fibrinogen-like domain separated by a short flexible region. Angiopoietin-1 binds and activates the receptor tyrosine kinase Tie-2, and its association into tetramers is important for full Tie-2 activation. Angiopoietin-1 ligation of Tie-2 on vascular endothelial cells (EC) induces the development and branching of blood vessels. In confluent EC (i.e. in homeostasis), multimeric Angiopoietin-1 enhances vascular integrity by promoting the in trans homotypic association of Tie-2 between EC or with the substratum. In addition, Angiopoietin-1 suppresses several VEGF-induced effects on the vasculature including endothelial permeability, stretch-induced release of Angiopoietin-2, and up-regulation of the leukocyte adhesion molecules VCAM-1, ICAM-1, and E-Selectin. Angiopoietin-1 also interacts with a variety of integrins and the extracellular matrix independently of Tie-2. These interactions support the adhesion, migration and stress resistance of EC, fibroblasts, and myocytes. Angiopoietin-1 can protect against pulmonary arterial hypertension, reduce the extent of fibrosis and remodeling in infarcted diabetic myocardium, and enhance tumor progression and metastasis.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
RCN3 Protein
CD68 Protein
Popular categories:
CD66c/CEACAM6
Ubiquitin-Specific Protease 9

Share this post on:

Author: Adenosylmethionine- apoptosisinducer