Name:
ACVR2A Protein
Synonyms:
Activin RIIA, ACTRIIA, Activin receptor type IIA, Activin RIIA
Species Name:
Mouse
Label Name:
Mouse Fc Tag
Marker Name:
Unconjugated
Accession:
P27038
Gene Id:
AILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPIEGRMDPEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
Molecular Weight:
45-65kDa (Reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied.6 months, -20 to -70 °C under sterile conditions after reconstitution.1 week, 2 to 8 °C under sterile conditions after reconstitution.Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4
Quality Statement:
Activin receptor type-2A (ACVR2A) is also known as Activin receptor type IIA, ACTR-IIA, ACTRIIA and ACVR2, which is single-pass type I membrane protein. They function through heteromeric complexes of type I and type II serine/threonine kinase receptors. Dimeric ligands bind to a type II receptor, such as Activin Receptor IIA (ActRIIA), which then associates with a type I receptor to initiate signal transduction. On ligand binding, ACVR2A forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. ACVR2A is a receptor for activin A, activin B and inhibin A as well. Mature human ActRIIA is a 70 kDa glycoprotein that consists of a 116 amino acid (aa) extracellular domain (ECD), a 26 aa transmembrane segment, and a 352 aa cytoplasmic region that includes the kinase domain and a PDZ-binding motif. Activin proteins are involved in a wide range of biological processes including mesoderm induction, neural cell differentiation, bone remodeling, hematopoiesis, the regulation of reproductive physiology, inflammation, and carcinogenesis.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
EphB1 Protein
APOBEC3A Protein
Popular categories:
DSC3
G-Protein-Coupled Receptors (GPCRs)
