Share this post on:

Adiponectin Protein FCAR/CD89 Protein

Adiponectin; 30 kDa Adipocyte Complement-Related Protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte; C1q and Collagen Domain-Containing Protein; Adipose Most Abundant Gene Transcript 1 Protein; apM-1; Gelatin-Binding Protein; ADIPOQ; ACDC; ACRP30; APM1; GBP28Immunoglobulin Alpha Fc Receptor; IgA Fc Receptor; CD89; FCAR

Human Human

His TagHis Tag

UnconjugatedUnconjugated

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNGGGSHHHHHHQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQNGGGSGGGSHHHHHHHHHH

36 kDa(Reducing)42-55 kDa(Reducing)

>95%, by SDS-PAGE under reducing conditions>95%, by SDS-PAGE under reducing conditions

Lyophilized PowderLyophilized Powder

<0.1EU/μg<0.1EU/μg

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. · 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

PBS, pH7.4PBS, pH7.4

Adiponectin(ADPN) is a hormone secreted by adipocytes that regulates energy homeostasis and glucose and lipid metabolism. Adiponectin is a new member of the family of soluble defense collagens, in hematopoiesis and immune responses. It is an important negative regulator in hematopoiesis and immune systems and raise the possibility that it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin is mapped to 3q27 and can protect the organism from systemic inflammation by promoting the clearance of early apoptotic cells by macrophages through a receptor-dependent pathway involving calreticulin. The standard product used in this kit is the product of gene recombination, consisting of 226(19-244) amino acids with the molecular mass of 36KDa after glycosylation.FCAR, also known as Fc alpha RI or CD89, is a 50-100 kDa glycosylated bone marrow-specific type I transmembrane (TM) Fc receptor, which is a member of the immunoglobulin gene superfamily. FCAR exists on the surface of myeloid cells such as neutrophils, monocytes, macrophages and eosinophils, and mediates the immune response to pathogens. It interacts with IgA-regulated targets and triggers a variety of immune defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity and stimulating the release of inflammatory mediators. This product is made by recombinant expression of human FCAR from HEK293 cell line, purified, sterilized, filtered, packaged and freeze-dried.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations: FSH Protein GASP-1/WFIKKN2 Protein IL-5 Receptor IgG2A

Share this post on:

Author: Adenosylmethionine- apoptosisinducer