Share this post on:

GM-CSFR α Protein Adiponectin Protein

GMR, CD116, CSF2R, SMDP4Adiponectin; 30 kDa Adipocyte Complement-Related Protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte; C1q and Collagen Domain-Containing Protein; Adipose Most Abundant Gene Transcript 1 Protein; apM-1; Gelatin-Binding Protein; ADIPOQ; ACDC; ACRP30; APM1; GBP28

Mouse Human

His TagHis Tag

UnconjugatedUnconjugated

LLAPTTPDAGSALNLTFDPWTRTLTWACDTAAGNVTVTSCTVTSREAGIHRRVSPFGCRCWFRRMMALHHGVTLDVNGTVGGAAAHWRLSFVNEGAAGSGAENLTCEIRAARFLSCAWREGPAAPADVRYSLRVLNSTGHDVARCMADPGDDVITQCIANDLSLLGSEAYLVVTGRSGAGPVRFLDDVVATKALERLGPPRDVTASCNSSHCTVSWAPPSTWASLTARDFQFEVQWQSAEPGSTPRKVLVVEETRLAFPSPAPHGGHKVKVRAGDTRMKHWGEWSPAHPLEAEDTRVPGGGSHHHHHHHHETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNGGGSHHHHHH

44-60kDa36 kDa(Reducing)

>95% by SDS-PAGE>95%, by SDS-PAGE under reducing conditions

Lyophilized PowderLyophilized Powder

<0.1EU/μg<0.1EU/μg

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.

12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles. · 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

PBS, pH7.4PBS, pH7.4

GM-CSF receptor alpha is a member of the cytokine family of receptors. GM-CSF receptor alpha is found in the pseudoautosomal region of the X and Y chromosomes. GM-CSF receptor alpha has different isoform, with some of the isoforms being membrane-bound and others being soluble. Soluble GM-CSF receptor alpha subunit is a soluble isoform of the GMR alpha that is believed to arise exclusively through alternative splicing of the GMR alpha gene product. The sGMR alpha mRNA is expressed in a variety of tissues, but it is not clear which cells are capable of secreting the protein. Hereditary pulmonary alveolar proteinosis (hPAP) is a rare disorder of pulmonary surfactant accumulation and hypoxemic respiratory failure caused by mutations in GM-CSF receptor alpha, which results in reduced GM-CSF-dependent pulmonary surfactant clearance by alveolar macrophages. While no pharmacologic therapy currently exists for hPAP, it was recently demonstrated that endotracheal instillation of wild-type or gene-corrected mononuclear phagocytes results in a significant and durable therapeutic efficacy in a validated murine model of hPAP.Adiponectin(ADPN) is a hormone secreted by adipocytes that regulates energy homeostasis and glucose and lipid metabolism. Adiponectin is a new member of the family of soluble defense collagens, in hematopoiesis and immune responses. It is an important negative regulator in hematopoiesis and immune systems and raise the possibility that it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin is mapped to 3q27 and can protect the organism from systemic inflammation by promoting the clearance of early apoptotic cells by macrophages through a receptor-dependent pathway involving calreticulin. The standard product used in this kit is the product of gene recombination, consisting of 226(19-244) amino acids with the molecular mass of 36KDa after glycosylation.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations: Animal-Free FGF-13 Protein BGLAP Protein PDGF-R-beta DENV Non-structural Protein 1 (NS1)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer