Share this post on:

Name: PD-L1 Protein

Synonyms: Programmed cell death 1 ligand 1, CD274, B7-H1, Programmed death ligand 1

Species Name: Human

Label Name: His Tag

Marker Name: Unconjugated

Gene Id: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERHHHHHH

Molecular Weight: 30-35 KD(Reducing)

Purity: >95%, by SDS-PAGE under reducing conditions

Physical Appearance Name: Lyophilized Powder

Endotoxin Name: <0.1EU/μg

Reconstitution: Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage: · 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System: PBS, pH 7.2,5% trehalose

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations: TRAIL/TNFSF10 Protein CD212/IL-12R beta 1 Carboxypeptidase E

Share this post on:

Author: Adenosylmethionine- apoptosisinducer