FGF-4 Protein Noggin Protein
HBGF-4; HST Protein; HST-1; HSTF1; K-FGF; KFGFNoggin; SYM1; SYNS1; NOG
Human Human
No TagNo Tag
UnconjugatedUnconjugated
MAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRLQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
17kDa (Reducing)30kDa (Reducing)
>95% by SDS-PAGE>98% by SDS-PAGE & RP-HPLC
Lyophilized PowderLyophilized Powder
<1EU/μg<0.1EU/μg
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
12 months from date of receipt, -20 to -70 °C as supplied.6 months, -20 to -70 °C under sterile conditions after reconstitution.1 week, 2 to 8 °C under sterile conditions after reconstitution.Please avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied.6 months, -20 to -70 °C under sterile conditions after reconstitution.1 week, 2 to 8 °C under sterile conditions after reconstitution.Please avoid repeated freeze-thaw cycles.
20mM Tris, 150mM NaCl, pH8.0PBS, pH7.4
Fibroblast Growth Factor 4, a secreted heparin-binding protein, is a member of the fibroblast growth factor (FGF) family. FGF4 plays an essential role in the midgut patterning as it inhibits the foregut development and promotes the midgut and hindgut identity. Thus FGF4 induces the intestinal fate, repressing anterior markers such as hematopoietically expressed homeobox 1 (HEX1) and enhancing midgut markers such as PDX1 and CDX2. Also, Wnt signaling is essential to the midgut and hindgut development; high Wnt activity is required to repress foregut development and push towards an intestinal fate. As an example, the a fore mentioned transcription factor BARX1, which is expressed during foregut embryogenesis, induces SFRP1 and SFRP2 which in turn inhibit Wnt signaling, thus repressing midgut fate and favoring the foregut fate. Another crucial transcription factor of intestinal specification is CDX2. CDX2 is expressed early during the anterior-posterior formation of the gut tube and is essential for specifying the intestinal endoderm. Wnt induces the expression of CDX2, thus reinforcing its predominant role in intestinal specification.Noggin is a 67 kD homodimeric glycoprotein, which was the first BMP antagonist to have its crystallographic structure resolved at high resolution. The Noggin structure shares with that of its BMP ligands, the TGF-β cytokine superfamily fold of a cystine-knot domain, containing two β-strand finger-like loops. Noggin exists as a dimer of identical subunits and resembles a flat “butterfly-like” shape with the helical regions of the two subunits in close contact with each other as the body of the butterfly, and the β-strands of each subunit projecting outward as wings in parallel with each other, and at some 45° away from the axis of symmetry of the dimer. In mice heterozygous for Noggin gene deletion, various skeletal abnormalities arise due to cartilage hyperplasia and failures to initiate joint formation. All these abnormalities may be attributed to inadequate attenuation of BMP activity in the affected tissues. Noggin has been reported to be a specific inhibitor of BMP activity in mesenchymal cells. Noggin regulates the response of undifferentiated cells to BMPs through a negative feedback mechanism that maintains the cells in an undifferentiated state, thus controlling the rate of cell growth. The suggested mechanism of inhibition is based on the binding of Noggin to BMPs, which prevents them from interacting with cell surface receptors. Because of the feedback process, the BMPs in turn induce the mesenchymal cells to express Noggin. Once the process of cell differentiation and proliferation is activated, the production of Noggin is reduced. Noggin has various activities of relevance to potential future regenerative strategies for neurological disorders and injury. Administration of recombinant Noggin has been reported to improve brain recovery from ischemic injury by promoting microglia activation. Beyond regulating the fate of neural cells, Noggin has been shown to be a potent inducer of adipocyte formation in mesenchymal stem cell cultures.
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations: FGFR-2 alpha IIIb Protein Rev-Erb beta EGFR